PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 71303
Common NameNAM2-1, NAM2-2, SELMODRAFT_67245, SELMODRAFT_71303
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family NAC
Protein Properties Length: 168aa    MW: 19442 Da    PI: 10.204
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
71303genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.12.4e-5511371129
    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk......... 95 
            lppGfrFhPtdeel+++yL kkve++k+++ ++i++vd++k ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkd++++++         
  71303   1 LPPGFRFHPTDEELIDCYLIKKVENNKFSV-RAIQDVDLNKNEPWELPDKAKMGEKEWYFFTLRDRKYPTGMRTNRATEAGYWKATGKDRDITRTsansttnss 103
            79****************************.89***************99999****************************************98776665554 PP

    NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
            +++lvg kktLvfy+grapkg+kt+W+mheyrle
  71303 104 SNTLVGAKKTLVFYRGRAPKGVKTNWIMHEYRLE 137
            4445****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100558.541162IPR003441NAC domain
SuperFamilySSF1019413.53E-611162IPR003441NAC domain
PfamPF023652.5E-282136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
LPPGFRFHPT DEELIDCYLI KKVENNKFSV RAIQDVDLNK NEPWELPDKA KMGEKEWYFF  60
TLRDRKYPTG MRTNRATEAG YWKATGKDRD ITRTSANSTT NSSSNTLVGA KKTLVFYRGR  120
APKGVKTNWI MHEYRLEGEA AFLHNSRTSK DSEWVVCRIF QKSPGGKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-56116817171NAC domain-containing protein 19
4dul_A3e-56116817171NAC domain-containing protein 19
1ut7_B3e-56116817171NO APICAL MERISTEM PROTEIN
1ut7_A3e-56116817171NO APICAL MERISTEM PROTEIN
1ut4_B3e-56116817171NO APICAL MERISTEM PROTEIN
1ut4_A3e-56116817171NO APICAL MERISTEM PROTEIN
3swp_D3e-56116820174NAC domain-containing protein 19
3swp_C3e-56116820174NAC domain-containing protein 19
3swp_B3e-56116820174NAC domain-containing protein 19
3swp_A3e-56116820174NAC domain-containing protein 19
3swm_D3e-56116820174NAC domain-containing protein 19
3swm_C3e-56116820174NAC domain-containing protein 19
3swm_B3e-56116820174NAC domain-containing protein 19
3swm_A3e-56116820174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002960195.11e-124hypothetical protein SELMODRAFT_71303, partial
RefseqXP_002967512.11e-124hypothetical protein SELMODRAFT_67245, partial
SwissprotQ9FLJ22e-80NC100_ARATH; NAC domain-containing protein 100
TrEMBLD8QQ601e-124D8QQ60_SELML; Putative uncharacterized protein NAM2-1 (Fragment)
STRINGEFJ377341e-124(Selaginella moellendorffii)
STRINGEFJ321111e-124(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.14e-79NAC domain containing protein 100
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]